PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29739.m003775
Common NameRCOM_0712270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRF
Protein Properties Length: 253aa    MW: 28389.1 Da    PI: 9.2018
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29739.m003775genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.53.2e-2577120144
            WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                    d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  29739.m003775  77 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 120
                    79***************************************997 PP

2QLQ57.93.1e-20943236
            QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                   +FTa+Q+q+L++Q+l++Ky++++ P+P++Ll+ i+
  29739.m003775  9 PFTASQWQELEHQALIFKYMVSGIPIPSDLLFTIK 43
                   8******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.3E-11844IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.3E-15942IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.944944IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.9877121IPR014977WRC domain
PfamPF088797.4E-2178120IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MMSGTNKFPF TASQWQELEH QALIFKYMVS GIPIPSDLLF TIKRSCLDSP LSSKLFPRQP  60
PHIGWSCFQM GLGRKIDPEP GRCRRTDGKK WRCSKEAYPD SKYCERHMHR GKNRSRKPVE  120
VANQTATTTN PTVSSVTKNH SNLLTPPSHS LSLLSSDQSH LHYAGYHSHL NHQFLSSSHT  180
TSSRPPGIGL SPQDNSTPLL LDSSGSCSLA SADYRNAYGL KEEVDEHAFF SETSGSMRSY  240
LVHLWMMLGN LLH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0098463e-52AP009846.1 Lotus japonicus genomic DNA, clone: LjT02E24, TM1624a, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002516290.21e-177PREDICTED: LOW QUALITY PROTEIN: growth-regulating factor 1
TrEMBLB9RRC10.0B9RRC1_RICCO; Putative uncharacterized protein
STRINGPOPTR_0006s14560.11e-125(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40433459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-57growth-regulating factor 5